DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC116412104

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031761512.1 Gene:LOC116412104 / 116412104 -ID:- Length:248 Species:Xenopus tropicalis


Alignment Length:261 Identity:71/261 - (27%)
Similarity:105/261 - (40%) Gaps:70/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            :|:.||.....|.|:.|.|::  ....||||||:...|::|.||:.|...::  |||:       
 Frog    25 KIVGGHLCPEPSVPYQVSLNA--GYHFCGGSLISTLWVVSATHCYKARMKVI--LGEH------- 78

  Fly   109 CTGYYCNFR----EEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI--------- 158
                  |.|    .|..:.:.  ..|..|||....|||.::||:|.......::|:         
 Frog    79 ------NIRVLEGPEQFIQSAKVLPHPQYDPRLLDNDIMLVRLAKPARINSRVQPVSLPTHCTPV 137

  Fly   159 ---CVVWDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQTLDIRRQPPDVC-AKFIGQTIAGN 217
               |:|                 :|||||.....:  |.||.|.........| ..:.|| |..|
 Frog   138 GTDCLV-----------------SGWGKTLSNGVNYPDLLQCLIAPILSDRECQGSYPGQ-ITEN 184

  Fly   218 QFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLSHAEF 277
            ..|||..:  .:.|.|||||||   :.:...|     |:.|: ...|..|   .|:|.|.::..:
 Frog   185 MVCAGYLEGGKDACQGDSGGPL---VCNGELQ-----GVVSW-GEGCAHAGYPGVYTKVCNYGAW 240

  Fly   278 I 278
            |
 Frog   241 I 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/259 (27%)
Tryp_SPc 45..278 CDD:238113 70/258 (27%)
LOC116412104XP_031761512.1 Tryp_SPc 26..241 CDD:238113 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.