DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC116411715

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:359 Identity:97/359 - (27%)
Similarity:142/359 - (39%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQL--LHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD---MFVCGG 73
            |..:|.|  |...|...:...||.|.......||:.|..:.....||||.:.|.|.   ..:|||
 Frog     9 IFFIFSLFNLFPECESAIGGICGNRPLFNKGSRIVGGQNSPPGKWPWMVSIQSPTGKEFSHLCGG 73

  Fly    74 SLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHM-----------VDAGFK 127
            |::.:..||||||||   :||         .|.||...:...|...::           :....:
 Frog    74 SVLNEIWVLTAAHCF---KHL---------QRKEETKSWRLVFGANNLKVLESSVQIRKIKEVIQ 126

  Fly   128 HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES--DS 190
            .|.|:|.|.||||.:|||.|.:|:.|.::|.|  :...:.:...|.|...| |||....||  .|
 Frog   127 PKAYNPTTEANDITLLRLDKPIVFTDYVQPAC--FPTEFANVEKKTDCYIA-GWGVLDEESGEPS 188

  Fly   191 DALQTLDIRRQPPDVC--AKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQ 251
            :.||...:.:.....|  ..:....|.....|||:....:  |.|||||||  :...:.::.:..
 Frog   189 EILQEARVHQIDSKKCNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPL--MCKTQKSRTYAV 251

  Fly   252 VGIASYTNRNC---QKASVFTDVLSHAEFI-------------LRVWRMYGKGQTLPIPKKPPTT 300
            |||.|: ...|   :|..|:|......::|             :|..|...|...||..:.|...
 Frog   252 VGITSW-GSGCARGKKPGVYTSTKYFIKWIASKVETDEKEKPKIRKKRSLLKNIILPNGQLPDAE 315

  Fly   301 TRPPTWWHTTRI------PKQTFQDYDYDTNHGS 328
            |...|...|...      |....|::.|....|:
 Frog   316 TEELTQTQTQGTETNPVRPTAQIQEFQYGREKGT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/256 (29%)
Tryp_SPc 45..278 CDD:238113 74/255 (29%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.