DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and St14

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:268 Identity:83/268 - (30%)
Similarity:123/268 - (45%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPA---CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAH 86
            ||...|..   ||:|:.::.| |::.|..|.....||.|.||:.....:||.|||:...:::|||
  Rat   593 CSDGSDEKNCDCGLRSFTKQA-RVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAH 656

  Fly    87 C------FIANQHLV--ARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAIL 143
            |      |..:.|.:  |.||..:::: ...:|.     :||.:.....|..::..|...|||:|
  Rat   657 CFQDETIFKYSDHTMWTAFLGLLDQSK-RSASGV-----QEHKLKRIITHPSFNDFTFDYDIALL 715

  Fly   144 RLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA--LQTLDIRRQPPDVC 206
            .|.|...|...:||||:. |:  .|.......:..||||.|: |..:.|  ||..:||......|
  Rat   716 ELEKPAEYSTVVRPICLP-DN--THVFPAGKAIWVTGWGHTK-EGGTGALILQKGEIRVINQTTC 776

  Fly   207 AKFIGQTIAGNQFC----AGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY----TNRNCQ 263
            .:.:.|.|.....|    :|..||  |.|||||||.:|   :...|..|.|:.|:    ..||  
  Rat   777 EELLPQQITPRMMCVGFLSGGVDS--CQGDSGGPLSSV---EKDGRIFQAGVVSWGEGCAQRN-- 834

  Fly   264 KASVFTDV 271
            |..|:|.:
  Rat   835 KPGVYTRI 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/246 (31%)
Tryp_SPc 45..278 CDD:238113 75/245 (31%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 3/8 (38%)
Tryp_SPc 615..852 CDD:238113 75/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.