DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and KLK8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:266 Identity:69/266 - (25%)
Similarity:108/266 - (40%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACG-IRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ 92
            |.||.| .|.|..   :::.||..:.:|.||...|.....: :|||.|:....|||||||  ...
Human    64 LPPAAGHSRAQED---KVLGGHECQPHSQPWQAALFQGQQL-LCGGVLVGGNWVLTAAHC--KKP 122

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY---DPNTHANDIAILRLSKSVVYRDN 154
            ....|||::.....:       ...:|..|.....|..|   |...|.:|:.:|:|.........
Human   123 KYTVRLGDHSLQNKD-------GPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSK 180

  Fly   155 IRPICVVWDHRWRHYLDKIDLLTATGWG--KTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGN 217
            ::||.:.     .|........|.:|||  .:..|:..|.|...:::..|...|.......|...
Human   181 VKPISLA-----DHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDG 240

  Fly   218 QFCAG-NWDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHA 275
            ..||| :..::.|.|||||||   ||:           .||.|:.:..|   .|..|:|::..:.
Human   241 MVCAGSSKGADTCQGDSGGPLVCDGAL-----------QGITSWGSDPCGRSDKPGVYTNICRYL 294

  Fly   276 EFILRV 281
            ::|.::
Human   295 DWIKKI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/245 (25%)
Tryp_SPc 45..278 CDD:238113 62/244 (25%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 62/245 (25%)
Tryp_SPc 78..300 CDD:238113 63/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.