DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:301 Identity:82/301 - (27%)
Similarity:134/301 - (44%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLLHSGCSQFLDPA--------------CGIRTQSRTAYRIINGHTAKYNSSPWMVFLH 63
            |..|.|.||..|....|:|.              |||:...    |:::|.:.:.:..||...:.
Mosquito    14 GAPLFFVLLWIGHVFGLEPVSSTQNTSSLPESPHCGIQLGD----RVLSGQSTQIDEFPWTALIE 74

  Fly    64 ----STTDMFVCGGSLITDKLVLTAAHCF--IANQHLV--ARLGEYERTRSEECTGYYCNFR--- 117
                ..:..|.||||||.|:.::|||||.  |.....|  .||||::.|.:.:|...:|:..   
Mosquito    75 FQKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRDWKVQRVRLGEWDLTSANDCQNEFCSDAPID 139

  Fly   118 ---EEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTAT 179
               |:.:|..|:..|   ..::|||||::|.::.|.|...:||||:......|:......:....
Mosquito   140 LDIEQIVVHTGYDTK---DKSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRSHDGLISYEV 201

  Fly   180 GWGKTQMESDSDALQTLDIRRQPPDVCAKFI---GQTIAGNQFCAGNWDS-NLCNGDSGGPLGAV 240
            ||.||...:.|:....:::..:....||...   |..:.....|||...| :.|:|:|||||   
Mosquito   202 GWRKTNSATASEKKLKVEVEIKSLQECAPIYERNGILLKQTHMCAGGVRSKDTCSGNSGGPL--- 263

  Fly   241 ITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFI 278
             ..:.|..:..:|:.|:..|.|..   ..|:|:|..:.::|
Mosquito   264 -MRQMTGSWYLIGVNSFGPRKCGTFGVPDVYTNVAEYVDWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/254 (28%)
Tryp_SPc 45..278 CDD:238113 69/253 (27%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 70/254 (28%)
Tryp_SPc 59..306 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.