DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP013252

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003436670.1 Gene:AgaP_AGAP013252 / 11175997 VectorBaseID:AGAP013252 Length:597 Species:Anopheles gambiae


Alignment Length:329 Identity:87/329 - (26%)
Similarity:147/329 - (44%) Gaps:72/329 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMF----QLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH---STTDM 68
            |:.:|.:|    ::..:.....:...||.| :.:|.|.:.:|...|....||...::   .|...
Mosquito     8 FLALIAVFCAIGEVRKTNALDTVPLECGER-KVKTIYLVQHGTETKEGHWPWHTAIYHREQTNFE 71

  Fly    69 FVCGGSLITDKLVLTAAHCFIANQHLV------ARLGEYE----RTRSEECTGYYCNFREEHMVD 123
            :|||||::....:||||||...::.|:      .::|..:    ..||:|      :..|:.:|.
Mosquito    72 YVCGGSILDRNTILTAAHCLYTSRGLIKLDQLSVQVGRNQLSEASVRSQE------HHPEQLIVH 130

  Fly   124 AGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLL-----TATGWGK 183
            .||     .||:..:|||:::|:..:.....::|:| :|...     ..:||:     |..|:|.
Mosquito   131 PGF-----SPNSVTDDIALIKLATDITMTRYVQPVC-LWSLE-----PNLDLIVGRNGTVVGFGL 184

  Fly   184 TQMESDSDALQTLDIRRQPPDVC----AKFIGQTIAGNQFCAGNWDS-NLCNGDSGGPLGAVITH 243
            |:.:..||.|:...|.......|    .:..|.|:..|.:|.|.... ::|||||||  |....|
Mosquito   185 TEHDRVSDYLRQAAIAVVDSWTCIESDRQVYGVTLTANMYCGGGKTGVSVCNGDSGG--GMFFEH 247

  Fly   244 KNTQRFVQVGIASY--TNRN---CQ--KASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPT-- 299
            .:|. :|: |:.|:  ...|   |.  |.:|||||..:.::|         ||.:     .||  
Mosquito   248 GDTW-YVR-GVVSFMPLRENVGLCDGTKYTVFTDVAKYRDWI---------GQNV-----NPTLA 296

  Fly   300 TTRP 303
            :|||
Mosquito   297 STRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/263 (27%)
Tryp_SPc 45..278 CDD:238113 71/262 (27%)
AgaP_AGAP013252XP_003436670.1 Tryp_SPc 47..287 CDD:214473 71/260 (27%)
Tryp_SPc 48..287 CDD:238113 71/259 (27%)
Tryp_SPc 334..575 CDD:214473
Tryp_SPc 335..575 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.