DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP013020

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003435910.1 Gene:AgaP_AGAP013020 / 11175979 VectorBaseID:AGAP013020 Length:454 Species:Anopheles gambiae


Alignment Length:338 Identity:84/338 - (24%)
Similarity:132/338 - (39%) Gaps:81/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTALIGVPTFVGIILMFQLLHS-----------------GCSQFLDPA----CGIRTQSRTAYRI 45
            ||...|......|:....|.|:                 ...|:..|.    ||:..:..:.|. 
Mosquito   140 HTICAGQKVTGQIVTTINLQHTLYPSTQSLVSTNDGTNVNVIQYQPPQTPVDCGLPDKGFSHYS- 203

  Fly    46 INGHTAKYNSSPWMV-FLH---STTDMFVCGGSLITDKLVLTAAHCF---------IANQHLVAR 97
            |||..|.....||.. ..|   |:...::||.:::|::.::|||||.         :::..:|..
Mosquito   204 INGVHAHKGMFPWAAPIFHTGSSSKPRYICGSTILTERHLVTAAHCVYNSDGIKQNVSDLTVVPG 268

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTH--------ANDIAILRLSKSVVYRDN 154
            :...:            ||.|..:.:.|.| |::..|.:        ..|||:|.|...:.|...
Mosquito   269 MHNID------------NFFEADLQERGVK-KIFVHNDYFFEHGMLVDADIAVLLLDDPITYNKL 320

  Fly   155 IRPICVVWDHRWRHYLDKI--DLLTATGWGKTQ---MESDSDALQTLDIRRQPPDVCAKFIGQTI 214
            :|||| :|..  ...|:||  |....:|||.|:   .:..|..:.|: :.||   .|.:.:.:..
Mosquito   321 VRPIC-MWSD--SDNLEKIVGDEGFVSGWGVTEDGKAKIPSYVMATV-VDRQ---TCNRNLDRLF 378

  Fly   215 AGNQ--FCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-----TNRNC--QKASVFTD 270
            |...  |||....|..|.||||.  |.||  |...|:...||.|:     ....|  .|..|:||
Mosquito   379 AAKARIFCADGHGSVPCTGDSGS--GFVI--KRGPRYYIRGIVSFGQFDPKTLTCATDKYVVYTD 439

  Fly   271 VLSHAEFILRVWR 283
            :.....::.||.:
Mosquito   440 IAPFRYWLTRVMK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/268 (26%)
Tryp_SPc 45..278 CDD:238113 71/267 (27%)
AgaP_AGAP013020XP_003435910.1 GD_N 46..146 CDD:292649 2/5 (40%)
Tryp_SPc 204..450 CDD:238113 71/269 (26%)
Tryp_SPc 204..446 CDD:214473 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.