DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003436374.1 Gene:CLIPB9 / 11175774 VectorBaseID:AGAP013442 Length:401 Species:Anopheles gambiae


Alignment Length:276 Identity:90/276 - (32%)
Similarity:126/276 - (45%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL----HSTTDMFVCGGSLITDKLVLTAAHCFIANQH 93
            ||:    ....||..|..|..:..||:..|    ......:.||||||..:.|||||||.|....
Mosquito   140 CGV----SIGMRIYGGQNADIDEFPWLALLQYENRKGERKYSCGGSLINRRYVLTAAHCVIGEVE 200

  Fly    94 -----LVA-RLGEYERTRSEECTGYYCNFREEH-------MVDAGFK----HKLYDPNTHANDIA 141
                 ||: |||||......:|.      .||.       .:|||.:    |..|....||:|||
Mosquito   201 RKEGKLVSVRLGEYNTKTEIDCV------TEEQEEICADPPIDAGIESVIVHPGYQDMAHADDIA 259

  Fly   142 ILRLSKSVVYRDNIRPICV-VWDHRWRHYLDKI-DLLTATGWGKTQMESDSDALQTLDIRRQPPD 204
            :|||::|:.|...::|:|: :.|.|    ..|. ::...||:|:|..||.|...|.|.|:.....
Mosquito   260 LLRLAQSIEYTSFVQPVCLPLTDFR----ASKTGEVNFVTGFGRTLQESRSAVKQKLGIKVYDHA 320

  Fly   205 VC-AKFI--GQTIAGNQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC--- 262
            .| .|:.  ..:|..||.|| |.:..:.|:|||||||     .|..:.:...||.||.|| |   
Mosquito   321 RCQEKYATKNSSITTNQLCAGGEYAKDSCHGDSGGPL-----MKLQKVWYLEGIVSYGNR-CGLE 379

  Fly   263 QKASVFTDVLSHAEFI 278
            ....|:|.|.::..::
Mosquito   380 DWPGVYTHVPAYMAWV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 88/263 (33%)
Tryp_SPc 45..278 CDD:238113 87/262 (33%)
CLIPB9XP_003436374.1 CLIP 31..85 CDD:288855
Tryp_SPc 147..395 CDD:214473 88/263 (33%)
Tryp_SPc 148..398 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.