DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:261 Identity:76/261 - (29%)
Similarity:119/261 - (45%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDM-------FVCGGSLITDKLVLTAAHCFIANQHLVARLGEY- 101
            |:.|..|||...|....|..:.:.       |.|||:||:|:.:|||||||.....::.|:||| 
Mosquito    69 IVGGEQAKYGEFPHHALLGFSKENGNQWDYDFRCGGTLISDQHILTAAHCFAYGDPVIVRVGEYD 133

  Fly   102 -ERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHR 165
             |....:|......:.|         :|..|......:|||:::|...:|...:|||.| :|:..
Mosquito   134 TELETDDEYDSDIASIR---------RHPNYSNLRSYDDIALVKLKHPIVLSKHIRPAC-LWETE 188

  Fly   166 WRHYLDKIDLLTATGWG--KTQMESDSDALQTLDIRRQPPDVCAK-FIG-----QTIAGNQFCAG 222
            .|:....|    |||:|  :|...:.|..:..:::...|...|.: |.|     |.:...|.|.|
Mosquito   189 ERNSTRYI----ATGFGYNETYGTTLSTVMMKVNLDEFPVSDCERNFKGDRRFKQGVRDGQLCVG 249

  Fly   223 N--WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFIL-RV 281
            :  ...:.|.||||||| .|:|:..:..:..|||.| ....|   ...:::|.|..:.::|. .|
Mosquito   250 SIVEGRDTCQGDSGGPL-QVVTNTKSCSYGVVGITS-VGGVCGIGNAKAIYTKVSHYIDWIEDNV 312

  Fly   282 W 282
            |
Mosquito   313 W 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/254 (29%)
Tryp_SPc 45..278 CDD:238113 73/254 (29%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 74/257 (29%)
Tryp_SPc 69..308 CDD:214473 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.