Sequence 1: | NP_995714.2 | Gene: | CG18636 / 2768923 | FlyBaseID: | FBgn0032551 | Length: | 349 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021329151.1 | Gene: | LOC110439065 / 110439065 | -ID: | - | Length: | 251 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 59/209 - (28%) |
---|---|---|---|
Similarity: | 91/209 - (43%) | Gaps: | 43/209 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEEC 109
Fly 110 TGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID 174
Fly 175 -LLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNL--------- 228
Fly 229 -----CNGDSGGPL 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18636 | NP_995714.2 | Tryp_SPc | 44..278 | CDD:214473 | 59/209 (28%) |
Tryp_SPc | 45..278 | CDD:238113 | 59/209 (28%) | ||
LOC110439065 | XP_021329151.1 | Tryp_SPc | 26..247 | CDD:238113 | 59/209 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |