DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and F11

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:325 Identity:86/325 - (26%)
Similarity:129/325 - (39%) Gaps:96/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GVPTFVGIILMFQLLH--SGCSQF------LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH 63
            |.||        ::||  .|.|.:      :|..|..:...    |::.|..:.:...||.|.||
Mouse   356 GSPT--------RILHGRGGISGYSLRLCKMDNVCTTKINP----RVVGGAASVHGEWPWQVTLH 408

  Fly    64 STTDMFVCGGSLITDKLVLTAAHCF--------------IANQHLVARLGEYERTRSEECTGYYC 114
             .:...:||||:|.::.:|||||||              |.||           :...|.|.:  
Mouse   409 -ISQGHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVNQ-----------SEINEGTAF-- 459

  Fly   115 NFREEHMVDAGFKHKLYDPNTHAN---DIAILRLSKSVVYRDNIRPICV--------VWDHRWRH 168
             ||.:.|:       ::|..|.|.   |||:|:|..::.|.|..||||:        |....|  
Mouse   460 -FRVQEMI-------IHDQYTTAESGYDIALLKLESAMNYTDFQRPICLPSKGDRNAVHTECW-- 514

  Fly   169 YLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVC-AKFIGQTIAGNQFCAG--NWDSNLC 229
                     .||||.|.:..: ...||...:.....:.| .::....|.....|||  ....:.|
Mouse   515 ---------VTGWGYTALRGEVQSTLQKAKVPLVSNEECQTRYRRHKITNKMICAGYKEGGKDTC 570

  Fly   230 NGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFILRVWRMYGKGQTL 291
            .|||||||..    |....:..|||.|: ...|   ::..|:|:|..:.::||.      |.||:
Mouse   571 KGDSGGPLSC----KYNGVWHLVGITSW-GEGCGQKERPGVYTNVAKYVDWILE------KTQTV 624

  Fly   292  291
            Mouse   625  624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/265 (27%)
Tryp_SPc 45..278 CDD:238113 71/264 (27%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519 7/27 (26%)
Tryp_SPc 389..617 CDD:214473 72/265 (27%)
Tryp_SPc 390..617 CDD:238113 71/264 (27%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.