DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss48

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:312 Identity:88/312 - (28%)
Similarity:128/312 - (41%) Gaps:91/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLL---HSGC---SQFLDPACGIRTQSRTAY--RIINGHTAKYNSSPWMVFLH--STTD 67
            |::::..||   :.|.   .:.|...||     |..|  ||:.|..|.....||.|.|.  ||  
  Rat     5 GLMVLLLLLLGAYQGSLTKQKKLQSVCG-----RPVYSGRIVGGQGAALGHWPWQVSLRFDST-- 62

  Fly    68 MFVCGGSLITDKLVLTAAHC-------FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG 125
             .:||||||::..|:|||||       |:.:    ..||..:|..|.  ||      ||:.|.  
  Rat    63 -HICGGSLISNHWVMTAAHCIKKTWFSFLYS----VWLGSIDRDYSS--TG------EEYYVS-- 112

  Fly   126 FKHKLYDPNTHAN---DIAILRLSKSVVYRDNIRPICV------------VWDHRWRHYLDKIDL 175
               ::..|:.|.|   |||:|:||..|.:...:.|||:            .|             
  Rat   113 ---RIVIPSKHHNTDGDIALLKLSSRVTFTSLVLPICLPNISKPLTVPASCW------------- 161

  Fly   176 LTATGWGKTQMESDSDALQTLDIRRQPPDVCAKF---IG-------QTIAGNQFCAG--NWDSNL 228
              .||||:.|.......||.|::.....:.|.:.   ||       :.|..:..|||  ....:.
  Rat   162 --VTGWGQNQEGHYPSTLQELEVPIITGEACEQLYNPIGFFLPDLERIIKEDMLCAGEIQQSKDS 224

  Fly   229 CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK--ASVFTDVLSHAEFI 278
            |.|||||||...|...    :.|:|:.|: ...|.|  ..|:|:|..:.::|
  Rat   225 CKGDSGGPLSCHIDGV----WTQIGVISW-GLECGKNLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/271 (29%)
Tryp_SPc 45..278 CDD:238113 77/270 (29%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.