DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:287 Identity:87/287 - (30%)
Similarity:126/287 - (43%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SQFLD----PACGIRTQSRTAYRIINGHTAKYNSS----PWMVFLHSTTDMFVCGGSLITDKLVL 82
            ||.||    ..|||...:.:     ||.....|||    ||...|:..:.. .||||||..:.||
Zfish   286 SQALDSPSAAVCGIIPVNSS-----NGTVGGQNSSAVHWPWQASLYWYSGQ-TCGGSLINKEWVL 344

  Fly    83 TAAHCFIANQ---HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILR 144
            :|||||...:   :|...||  .:|:::     |...|....|.|..||..|:|||:.||||::|
Zfish   345 SAAHCFNGQRNGFYLTVILG--PKTQNK-----YDPSRISRSVKAVIKHPYYNPNTNDNDIALVR 402

  Fly   145 LSKSVVYRDNIRPICVV------------WDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLD 197
            ||..:.:.|:|||:|:.            |...||:..|.:.|            ......|.::
Zfish   403 LSFPITFTDSIRPVCLAAEGSVFNSDTESWITTWRNISDGVPL------------PSPKIFQEVE 455

  Fly   198 IRRQPPDV------CAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            :    |.:      |...:| :|..|..|||  ....:||.||||||:    ....:..:||.||
Zfish   456 V----PVIGNRQCNCLYGVG-SITDNMICAGLLKEGKDLCQGDSGGPM----VSNQSSVWVQSGI 511

  Fly   255 ASYTNRNCQKA---SVFTDVLSHAEFI 278
            .|: ...|.::   .|:|.|..:.|:|
Zfish   512 VSF-GSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 79/263 (30%)
Tryp_SPc 45..278 CDD:238113 79/262 (30%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 77/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.