DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk15

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:284 Identity:64/284 - (22%)
Similarity:88/284 - (30%) Gaps:133/284 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITD 78
            ::|.|.||.|.              ::...:::.|.....:|.||.|.|.. ...|.||..||:.
  Rat     3 LLLAFILLVSA--------------AQDGDKVLEGEECVPHSQPWQVALFE-RGRFNCGAFLISP 52

  Fly    79 KLVLTAAHCFIANQHLVARLGEY--------ERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNT 135
            ..|||||||  ..:.:..||||:        |:.||               |.....|..|:..|
  Rat    53 HWVLTAAHC--QTRFMRVRLGEHNLRKFDGPEQLRS---------------VSRIIPHPGYEART 100

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200
            |.:||.:|||         .||                                         .|
  Rat   101 HRHDIMLLRL---------FRP-----------------------------------------AR 115

  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIASYTNRNC 262
            ..|                          .|||||||   ||:           .||.|:.:..|
  Rat   116 LTP--------------------------QGDSGGPLVCGGAL-----------QGIVSWGDVPC 143

  Fly   263 Q---KASVFTDVLSHAEFILRVWR 283
            .   |..|:|.|.|:.::|.:..|
  Rat   144 DTTTKPGVYTKVCSYMDWIRKNMR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/247 (23%)
Tryp_SPc 45..278 CDD:238113 57/246 (23%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.