DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:281 Identity:71/281 - (25%)
Similarity:114/281 - (40%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFL--DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAA 85
            ||.::.|  |...|..|:|.::.||:||.....::.||...|....:...||..||..:.:||||
  Rat    44 SGTNRDLNTDSNSGEDTRSDSSSRIVNGSDCPKDTQPWQGALLLGPNKLYCGAVLINPQWLLTAA 108

  Fly    86 HCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK---HKLYDPNTHANDIAILRLSK 147
            ||  .......|||.:..:..         :.....:..|.|   |..|....|:||:.::::::
  Rat   109 HC--RKPVFRIRLGHHSMSPV---------YESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNR 162

  Fly   148 SVVYRDNIRPI------------CVVWDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQTLDI 198
            .:....:::|:            |:|                 :|||.|....::  ..||.|||
  Rat   163 KIRASHSVKPVEITSDCPKEGTRCMV-----------------SGWGTTSSSHNNFPKVLQCLDI 210

  Fly   199 RRQPPDVCAKFIGQTIAGNQFCAGN---WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
            .....:.|.......|....||||:   .||  |.||||||   ||.:...|     |:.|:.:.
  Rat   211 TVLSEERCKNSYPGQIDKTMFCAGDEAGRDS--CQGDSGGP---VICNGKLQ-----GLVSWGDF 265

  Fly   261 NC---QKASVFTDVLSHAEFI 278
            .|   .:..|:|::   .||:
  Rat   266 PCAQPNRPGVYTNL---CEFV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/256 (25%)
Tryp_SPc 45..278 CDD:238113 62/255 (24%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.