DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and gprin3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017951795.1 Gene:gprin3 / 101733019 XenbaseID:XB-GENE-6468967 Length:725 Species:Xenopus tropicalis


Alignment Length:148 Identity:35/148 - (23%)
Similarity:58/148 - (39%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHR---WRHYLDKIDLLTATGWGKTQMESDS 190
            |...|:::|...:.::.:|||  :|      ||||.:   |..|...:|           .|:..
 Frog   611 KATPPSSNAEAKSQVKQTKSV--KD------VVWDEQGMTWEVYGASMD-----------PEALG 656

  Fly   191 DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQ-RFVQVGI 254
            .|:|. .::||..: ..|.|...:..|:       .::|:..||.      .||..| |..|..:
 Frog   657 IAIQN-HLQRQIRE-HEKMIRAQLKQNR-------KSICSDSSGK------KHKRRQHRVFQSIL 706

  Fly   255 ASYTNRNCQKASVFTDVL 272
            .::...||......|.||
 Frog   707 KNFRRPNCCARPPPTSVL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 35/148 (24%)
Tryp_SPc 45..278 CDD:238113 35/148 (24%)
gprin3XP_017951795.1 GRIN_C 600..720 CDD:373668 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.