DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC101732176

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:280 Identity:80/280 - (28%)
Similarity:119/280 - (42%) Gaps:57/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST--TDMFVCGGSLITDKLVLTAAHCFIANQHLV 95
            ||:.|  :...||:.|..|.....||.:.|...  |.:::||||:||...::|||||.       
 Frog   267 CGLST--KVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCV------- 322

  Fly    96 ARLGEYERTRSEE----------CTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVV 150
                 |..|.|..          .:.||   ...::||....|..|.|||...|||:|:|..::|
 Frog   323 -----YGYTSSPSIFKVFAGSLTLSNYY---SAGYLVDRVLIHPSYSPNTQNYDIALLKLKTALV 379

  Fly   151 YRDNIRPICVVWDHRWRHYLDKIDLLTA-------TGWGKT-QMESDSDALQTLDIRRQPPDVC- 206
            :..|:||:|          |..:.:..|       :|||.| :..|.|.:|:...:.......| 
 Frog   380 FSTNLRPVC----------LPNVGMPWADGQPCWISGWGTTSEAGSISTSLKAASVPIISSATCN 434

  Fly   207 -AKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIAS--YTNRNCQKAS 266
             |...|..|:....|||  ...::.|.|||||||   :|..|:..:: ||..|  |......|..
 Frog   435 LAPVYGGVISPTMICAGYLGGGTDTCQGDSGGPL---VTKTNSLWWL-VGDTSWGYGCARAYKPG 495

  Fly   267 VFTDVLSHAEFILRVWRMYG 286
            |:.::....|:|....:.||
 Frog   496 VYGNITVFLEWIYSQMQTYG 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/259 (29%)
Tryp_SPc 45..278 CDD:238113 73/258 (28%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 2/3 (67%)
Tryp_SPc 277..510 CDD:238113 74/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.