DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss2.1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_004912265.1 Gene:tmprss2.1 / 101731874 XenbaseID:XB-GENE-22065907 Length:482 Species:Xenopus tropicalis


Alignment Length:258 Identity:68/258 - (26%)
Similarity:106/258 - (41%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC----FIANQH 93
            ||..|:: ...||:.|..|.....||.|.| ...:..:||||:||...:||||||    :.:...
 Frog   237 CGSSTKN-VGNRIVGGSQASLGDWPWQVSL-QFNERHICGGSIITPNYILTAAHCVEGVYSSPYP 299

  Fly    94 LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            ....:|...::     ||     ...:.|.:...|:.||..|..||||::||...:.....::|:
 Frog   300 WTVYVGSLYKS-----TG-----GTRYSVKSLIGHQNYDTKTKNNDIALMRLKSPITLTSTVQPV 354

  Fly   159 C-----VVW---DHRWRHYLDKIDLLTATGWGKT-QMESDSDALQTLDIRRQPPDVCAKFI--GQ 212
            |     ::|   ...|           .:|||.| :..:.|..|....:.....|.|.:.:  ..
 Frog   355 CLPNAGMLWTSGQSCW-----------TSGWGATIEGGTSSGVLNAAMVPLIDSDTCNRAVVYNG 408

  Fly   213 TIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTN--RNCQKASVFTDV 271
            .:.....|||.....:  |.|||||||   :| |.:..:..||..|:..  .|..|..|:.::
 Frog   409 AVTATMICAGYLRGGIDSCQGDSGGPL---VT-KTSSLWWLVGDTSWGTGCANMNKPGVYGNI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/247 (26%)
Tryp_SPc 45..278 CDD:238113 64/246 (26%)
tmprss2.1XP_004912265.1 LDLa 112..143 CDD:238060
SRCR_2 148..241 CDD:373897 2/3 (67%)
Tryp_SPc 248..474 CDD:238113 64/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.