DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and prss56

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:290 Identity:75/290 - (25%)
Similarity:122/290 - (42%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLV---ARLGEYERTR 105
            ||:.|......|.||:|.:....:: :|||.|:.|..:|||||||..:.:.|   ..:|:|:.|:
 Frog    74 RIVGGSITSPGSWPWLVNIRFNGEL-MCGGVLLDDMWILTAAHCFTGSVNEVLWTVVVGQYDLTK 137

  Fly   106 SEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYL 170
            :.:       ..:...|:....|..::..|..||:|:|.|:.||....:.||:|:....|     
 Frog   138 NAQ-------GEKTFQVNRIVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPVPR----- 190

  Fly   171 DKIDLLTAT-----GWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQT-IAGNQFCAG--NWDS 226
               |....|     |||....:.. ||.:....:.....:.|...:|:. :....||||  |...
 Frog   191 ---DPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACRSTLGKNMLTSTMFCAGYLNGGI 252

  Fly   227 NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---------QKASVFTDVLSHAEFILRVW 282
            :.|.|||||||  ......::::|..||.|:.: .|         .:.:.|||.:||        
 Frog   253 DSCQGDSGGPL--TCQDPISKQYVLYGITSWGD-GCGERGKPGVYTRVTAFTDWISH-------- 306

  Fly   283 RMYGKGQTLPIPKKPPTTTRPPTWWHTTRI 312
                     .:.|.||  .|.||.:..:.:
 Frog   307 ---------QMNKSPP--IREPTCFELSEL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/254 (27%)
Tryp_SPc 45..278 CDD:238113 68/253 (27%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.