DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:295 Identity:77/295 - (26%)
Similarity:114/295 - (38%) Gaps:88/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLL--HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLIT 77
            :::|.||  |          ||..|      |.:.......||.||...|...|.. :||.:||.
Mouse     7 LVLFSLLAGH----------CGADT------RAVGARECVRNSQPWQAGLFYLTRQ-LCGATLIN 54

  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP----NTHAN 138
            |:.:||||||  ...:|..||||:...|.|       ...:..:|...|.|..::|    |.|.:
Mouse    55 DQWLLTAAHC--RKPYLWVRLGEHHLWRWE-------GPEQLLLVTDFFPHPGFNPDLSANDHND 110

  Fly   139 DIAILRLSKSVVYRDNIRPI------------CVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD 191
            ||.::||.:.|.....::|:            |::                 :|||..   |.|.
Mouse   111 DIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQCLI-----------------SGWGSV---SSSK 155

  Fly   192 -----ALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDS--NLCNGDSGGPL---GAVITHKNT 246
                 .||..:|......:|.......|:....|||.|:.  ..|.|||||||   |.:      
Mouse   156 LQYPMTLQCANISILDNKLCRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTL------ 214

  Fly   247 QRFVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
                 .||.|..:..|   ::.:|:|:|..:.|:|
Mouse   215 -----AGIVSGGSEPCSRPRRPAVYTNVFDYLEWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/262 (26%)
Tryp_SPc 45..278 CDD:238113 68/261 (26%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.