DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tpsab1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:113/311 - (36%) Gaps:96/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL--HSTTDMFVCGGSLI 76
            ::|...||.|.......||       .|...|:.|..|..|..||.|.|  :.|..|..||||||
Mouse     5 LLLTLPLLSSLVHAAPGPA-------MTREGIVGGQEAHGNKWPWQVSLRANDTYWMHFCGGSLI 62

  Fly    77 TDKLVLTAAHCF---IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTH 136
            ..:.|||||||.   :|:.:.|       |.:..:...||    .:|::...  ..|..:.....
Mouse    63 HPQWVLTAAHCVGPDVADPNKV-------RVQLRKQYLYY----HDHLMTVSQIITHPDFYIVQD 116

  Fly   137 ANDIAILRLSKSVVYRDNIRPI------------CVVWDHRWRHYLDKIDLLTATGWGKTQMESD 189
            ..|||:|:|:..|...|.:.|:            .:.|               .||||       
Mouse   117 GADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCW---------------VTGWG------- 159

  Fly   190 SDALQTLD--IRRQPP-------------DVC-AKFIGQTIAG--------NQFCAGNWDSNLCN 230
                 .:|  :...||             .:| .|:....|.|        :..||||...:.|.
Mouse   160 -----NIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQ 219

  Fly   231 GDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
            |||||||    ..|....::|.|:.|: ...|   .:..::|.|..:.::|
Mouse   220 GDSGGPL----VCKVEDTWLQAGVVSW-GEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/279 (25%)
Tryp_SPc 45..278 CDD:238113 69/278 (25%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 70/280 (25%)
Tryp_SPc 29..265 CDD:214473 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.