DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:271 Identity:76/271 - (28%)
Similarity:119/271 - (43%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQH---- 93
            ||:.|...:  ||:.|.:|.....||.|.| ...|..:||||:|....::|||||...:..    
 Frog   251 CGLSTYGES--RIVGGSSASIGDWPWQVNL-QYDDTNLCGGSVIAANWIVTAAHCVQGDTSSPSL 312

  Fly    94 LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            ..|.:|:.:.....:.:.|        .||....|..|...|::||||:::|..|:.:....||:
 Frog   313 WKAFIGKIKMPSYYDSSAY--------SVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPV 369

  Fly   159 C-----VVWDHRWRHYLDKIDLLTATGWGKT-QMESDSDALQTLDIRRQPPDVCAKFI--GQTIA 215
            |     :.|:.....|:        :|||.| |..|.|..|:...:....|..|.:.|  ...|.
 Frog   370 CLPNYGMQWEEGQPCYI--------SGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAIT 426

  Fly   216 GNQFCA----GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN--RNCQKASVFTDVLSH 274
            .:..||    |..||  |.|||||||   :|..|:..:: ||..|:.:  .|..:..|:.::...
 Frog   427 SSMICAGYPKGGVDS--CQGDSGGPL---VTKTNSLWWL-VGDTSWGDGCANVYRPGVYGNMTVF 485

  Fly   275 AEFILRVWRMY 285
            .::|....:||
 Frog   486 LQWIYLQMQMY 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/251 (28%)
Tryp_SPc 45..278 CDD:238113 69/250 (28%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 2/3 (67%)
Tryp_SPc 261..489 CDD:238113 69/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.