DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC100497505

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002940490.1 Gene:LOC100497505 / 100497505 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:282 Identity:80/282 - (28%)
Similarity:117/282 - (41%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIR-TQSRTAYRIINGHTAKYNSSPWMVFLH-----STTDMFVCGGSLITDKLVLTAAHCF--- 88
            ||:. .|..||.||::|:..:..|.||.|.|.     ....:.||||:||....:|||||||   
 Frog    38 CGVSFFQQNTAGRIVSGNEVRPYSWPWQVSLQVRPRGGKKYVHVCGGTLIHKSWILTAAHCFQKG 102

  Fly    89 ----IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYD-P--NTHANDIAILRLS 146
                .||..:|  :|::...|:|.....|       .|...::|:.:. |  |....|||:::.:
 Frog   103 KAEDAANWRIV--VGKHNLNRTEATEKVY-------SVKRIYRHERFSYPQLNDLDYDIALVKPA 158

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLLT-------ATGWGKTQMESDSDAL-QTLDIRRQP- 202
            :.::....|...|          |.|.::..       .||||.|:....:..| :.|:..|.| 
 Frog   159 EDIITTHFIHYAC----------LPKKEMAMHPGHFCWVTGWGDTRGGQGNVTLSEVLNQARLPI 213

  Fly   203 --PDVC--AKFIGQTIAGNQFCAG----NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259
              ...|  .||.|..|..:..|||    ......|.|||||||   :......|:...||.|:..
 Frog   214 IDTKTCRHKKFWGDRIRESMICAGFRNVGGPPAACQGDSGGPL---VCQDGRGRWEVHGIVSFGP 275

  Fly   260 RNC---QKASVFTDVLSHAEFI 278
            ..|   .|.||||...::..:|
 Frog   276 VGCTVENKPSVFTKTSTYIPWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/268 (28%)
Tryp_SPc 45..278 CDD:238113 73/267 (27%)
LOC100497505XP_002940490.1 Tryp_SPc 51..300 CDD:238113 74/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.