DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and XB5892359

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031752073.1 Gene:XB5892359 / 100497443 XenbaseID:XB-GENE-5892360 Length:426 Species:Xenopus tropicalis


Alignment Length:348 Identity:85/348 - (24%)
Similarity:145/348 - (41%) Gaps:88/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLDPACGIRTQSRTAY---RIINGHTAKYNSSPWMVFLHSTTD---MFVCGGSLITDKLVLTAAH 86
            |....||:|..:|:.:   |:|:|..|:..|.||:|.:....|   ..||||:::....|:||||
 Frog     3 FCSTDCGMRPLARSHHRVRRVIDGANAQPGSWPWIVSIQMPIDSVYRHVCGGTVLNHHWVMTAAH 67

  Fly    87 CFI---ANQHL---------VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAND 139
            |.:   :.|.|         |:.||...:.|           :.:.|:    :|:.::...:.||
 Frog    68 CLLKYQSEQSLARIVFGLFNVSDLGPETQIR-----------KIKEMI----RHEHFNKKENKND 117

  Fly   140 IAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWG----------------KTQMES 188
            ||::.|.:.|.:.|.|:|.|:   .:....:.:::.....|||                ||::.:
 Frog   118 IALIYLDRPVAFSDYIQPACL---PQQSSDITRMNDCYIAGWGLVDDYFRIRTDVLQEAKTELIA 179

  Fly   189 DSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQ 251
            :|...|            :.:....|.....|||  :...:.|:|||||||  :......:.:..
 Frog   180 NSRCNQ------------SDWYNGRIKEYNLCAGFEHGGPDTCDGDSGGPL--MCKRMKAKTYYI 230

  Fly   252 VGIAS------YTNRNCQKASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPT------TTRPP 304
            |||||      ::.||    .|:|......|:||...: ..|.:...|.||..:      :.|.|
 Frog   231 VGIASWGGLCGHSYRN----GVYTATQYFKEWILDKIK-NRKSENFSIYKKRTSRMIHERSARSP 290

  Fly   305 TWWHTTRIPKQTFQDYDYDTNHG 327
            .:..|.   |:||:|...:...|
 Frog   291 AFSFTN---KKTFKDTTTEITSG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/272 (24%)
Tryp_SPc 45..278 CDD:238113 65/271 (24%)
XB5892359XP_031752073.1 Tryp_SPc 22..259 CDD:214473 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.