DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and ovch2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:345 Identity:90/345 - (26%)
Similarity:134/345 - (38%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFI---ANQHLVARLGEYERTR 105
            ||:.|..:|....||.|.|......| |||.|::.:.||||:||.:   ...::....|||::|.
 Frog    63 RIVGGRESKKGQHPWTVSLKRNGKHF-CGGILVSRRHVLTASHCLLDRNVKSYIRVFFGEYDQTI 126

  Fly   106 SEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN-DIAILRLSKSVVYRDNIRPICV-----VWDH 164
            .|:.       .:...|...|||..::.....| |:|:|.|..:|.:.|||:|.|:     |::.
 Frog   127 KEDT-------EQTFKVIEIFKHPDFNYTQPMNYDVAVLVLDGAVTFDDNIQPACMPNPDDVFEP 184

  Fly   165 RWRHYLDKIDLLTATGWGK-TQMESDSDALQTLDIRRQPP--------DVCAKFIGQTIAGNQFC 220
            .        ||....|||. |:.......||.:.:    |        ||.|...|..::....|
 Frog   185 G--------DLCVTLGWGHLTENGILPGVLQEVLL----PLVNLSICLDVMATLKGAVVSSKIVC 237

  Fly   221 AG--NWDSNLCNGDSGGPL------GAVITHKNTQRFVQVGIASYTNRNCQKAS------VFTDV 271
            ||  ....:.|.|||||||      |..:.|..|...:..| .|:.|.....|:      :|||:
 Frog   238 AGFPEGGKDACQGDSGGPLLCQRRHGTWVLHGLTSWGMGCG-RSWKNNMFLPANRKGSPGIFTDI 301

  Fly   272 ---LSHAEFILRV--------------WRMYGKGQTLPIPKKPPTTTRPPTW--WHTTRIPKQ-- 315
               |....|.|..              ..:.||...|..|.|.....|....  |:.| :||.  
 Frog   302 QKLLGWVSFQLNTAVTKESKESCSVQDGVLSGKSGVLRFPHKNNLRYRNNELCRWNFT-VPKNMH 365

  Fly   316 ---TFQDYDYDTNHGSHWDW 332
               .|..:|.:::...:.|:
 Frog   366 ILLNFTHFDVESDISCNLDY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/268 (28%)
Tryp_SPc 45..278 CDD:238113 74/267 (28%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 74/265 (28%)
CUB 330..436 CDD:238001 13/57 (23%)
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.