DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC100495541

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:305 Identity:82/305 - (26%)
Similarity:120/305 - (39%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ---HLVARLGEYE--R 103
            ||:.|..|...:.||.|.|. ...:.:||||:|....:|||||||:.:|   ....|||.|:  .
 Frog    43 RIVGGSAATEGAWPWQVSLR-YKGIHICGGSVIGTHWILTAAHCFLISQSPSDFEVRLGAYQLSL 106

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV-------- 160
            |...|.|         :.||....:..:|.::|..|||::|.:..:.|...|.|:|:        
 Frog   107 TSPNEIT---------YKVDRIIVNSQFDSSSHYGDIALIRPTSPITYTPYILPVCLPSTSNSFP 162

  Fly   161 ----VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQT-------- 213
                .|               .||||.|..:.:....|||.      .|....|.:|        
 Frog   163 EGMECW---------------VTGWGTTAFQVNLPYPQTLQ------QVMTPLISRTSCDQMYHI 206

  Fly   214 ----------IAGNQFC----AGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC-- 262
                      |..:|.|    ||..||  |.|||||||    ..|....:.|:|..::.: .|  
 Frog   207 GTNVPSSTAIIPSDQICAGYAAGQKDS--CQGDSGGPL----VCKLQGIWYQIGFVTWGD-GCAI 264

  Fly   263 -QKASVFTDVLSHAEFILRVWRMYGKGQ-TLPIPKKPPTTTRPPT 305
             .:..|:|.|.::..::    ..|...: |:.:...|  ||.|||
 Frog   265 ANRPGVYTLVPAYQSWL----SSYNATENTVNVDSVP--TTAPPT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/275 (27%)
Tryp_SPc 45..278 CDD:238113 73/274 (27%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 73/280 (26%)
Tryp_SPc 362..595 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.