DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and mst1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:283 Identity:66/283 - (23%)
Similarity:111/283 - (39%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GCSQFLDPACGIRT-QSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC 87
            |....:..:||.|. :|....||:.|..   .:|||.|.|.:......|||||:.:..|::...|
 Frog   484 GAENIVFDSCGKRNDRSSQRTRIVGGMP---GNSPWTVSLRNRQGEHFCGGSLVKENWVISTRQC 545

  Fly    88 FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKH-KLYDPNTHA------------ND 139
            |              .:...:.:||      :.::...||: ...||:..:            :.
 Frog   546 F--------------SSCDADLSGY------QAVMGTLFKNPSPDDPDRQSVPISKIVCGPSDSS 590

  Fly   140 IAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPD 204
            :.:|:|.:.|.....:..||:..:   |:.:.:.......|||.|......:.|:.........|
 Frog   591 LVMLKLERPVTLNSRVALICLPPE---RYIVPEATKCEIAGWGDTGGTGHDNVLKIAIFHIISND 652

  Fly   205 VCAK-FIGQ--TIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK 264
            .|.| :..|  .:..|:.|..  ..|...|.||.|||| |.:||   ..:|..|:. ...|.|.|
 Frog   653 ECNKNYRSQRNKVLDNEMCTKPVPVDVGACEGDYGGPL-ACLTH---DCWVLEGVI-VPARGCGK 712

  Fly   265 ---ASVFTDVLSHAEFILRVWRM 284
               .::||.|..:.::|.:|.:|
 Frog   713 KNQPAIFTRVSVYVDWINKVMKM 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/254 (23%)
Tryp_SPc 45..278 CDD:238113 57/253 (23%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 58/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.