DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and corin

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_004911266.2 Gene:corin / 100492163 XenbaseID:XB-GENE-950958 Length:1123 Species:Xenopus tropicalis


Alignment Length:263 Identity:65/263 - (24%)
Similarity:109/263 - (41%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ----- 92
            ||.|..:|.:.||:.|.|::....||...|.|.....:||..||..|.|||.||||...:     
 Frog   871 CGRRPAARMSKRILGGRTSRPGRWPWQCSLQSDPSGHICGCVLIGKKWVLTVAHCFEGRESAAVW 935

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRP 157
            .:|..:...:         :..:|.:..:|.....|..|:......||:|:.|::.:.....:||
 Frog   936 KVVFGINNLD---------HPSDFAQTRLVKKIILHPRYNRAVVDYDISIVELNEDITETSYVRP 991

  Fly   158 ICVVWDHRWRHYLDKIDLLTATGWG----KTQMESDSDALQTLDIRRQPPDVCAKFIG-QTIAGN 217
            :|:....:   .::.......||||    |...:.....::.:.:.|     |..:.. :||...
 Frog   992 VCLPTKGQ---LVEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLER-----CQSYFDMKTITSR 1048

  Fly   218 QFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLSHAEF 277
            ..|||.....:  |.|||||||   :..|...::...|:.|:.:....|.   .|:::|....|:
 Frog  1049 MLCAGYESGTIDSCMGDSGGPL---VCEKPGGKWTLYGLTSWGSVCFSKVLGPGVYSNVSHFVEW 1110

  Fly   278 ILR 280
            |.|
 Frog  1111 IER 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/248 (24%)
Tryp_SPc 45..278 CDD:238113 58/247 (23%)
corinXP_004911266.2 CRD_corin_1 213..341 CDD:143554
LDLa 351..382 CDD:238060
LDLa 384..418 CDD:238060
LDLa 420..455 CDD:238060
LDLa 465..492 CDD:238060
CRD_corin_2 533..654 CDD:143579
LDLa 659..693 CDD:238060
LDLa 734..768 CDD:238060
Tryp_SPc 883..1114 CDD:238113 60/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.