DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and cfb

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031747347.1 Gene:cfb / 100491419 XenbaseID:XB-GENE-479361 Length:745 Species:Xenopus tropicalis


Alignment Length:290 Identity:62/290 - (21%)
Similarity:108/290 - (37%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SQFLDPACGIRTQSRTAYRIINGHTAKYNS------------SPWMVFLH-STTDMFVCGGSLIT 77
            |..:| .||:               :||:|            .||:..:. |.:.:..|.|::::
 Frog   448 SDVMD-TCGL---------------SKYHSVDPDERTRASEMFPWIAKITISGSSVQYCKGTILS 496

  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN---- 138
            ...:|||||||        .|.:..:.......|      :|:.|...::|..|:|.:..:    
 Frog   497 PYFILTAAHCF--------HLDDKNQKIQVIVDG------KEYPVKQPYRHPKYNPISKVDKNIK 547

  Fly   139 -----DIAILRLSKSVVYRDNIRPICVVWDHRWRHYL-----------------DKIDLLTATGW 181
                 |:.:|.|.|.:.:....||||:.........|                 :::..:.....
 Frog   548 RAFDYDVELLELQKKIEFSVTARPICIPCTQSTAQVLKVPGAPCSSHEKALLSEEEVKAIFIAEE 612

  Fly   182 GKTQMES-------DSDALQTLDIRRQPPDV-CAKFIGQTIAGNQFCAGN----WDSNLCNGDSG 234
            .|..:|.       .|.....|:..::.|:: ....|...:.....|.|.    .|..:|.||||
 Frog   613 SKNPLEQKNVIIKRGSKRTACLEAAKKAPELKNVTDIEDAVTEQFLCTGGIEPVVDPPVCKGDSG 677

  Fly   235 GPLGAVITHKNTQRFVQVGIASY-TNRNCQ 263
            |||  :|..:  :|:|||||.|: |..:|:
 Frog   678 GPL--IIPVR--RRYVQVGIISWGTVDHCE 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/272 (21%)
Tryp_SPc 45..278 CDD:238113 58/271 (21%)
cfbXP_031747347.1 PHA02927 <35..195 CDD:222943
vWA_complement_factors 240..442 CDD:238747
Tryp_SPc 474..732 CDD:238113 55/248 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.