powered by:
Protein Alignment CG18636 and akt1
DIOPT Version :9
Sequence 1: | NP_995714.2 |
Gene: | CG18636 / 2768923 |
FlyBaseID: | FBgn0032551 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004917247.1 |
Gene: | akt1 / 100490038 |
XenbaseID: | XB-GENE-484953 |
Length: | 493 |
Species: | Xenopus tropicalis |
Alignment Length: | 61 |
Identity: | 17/61 - (27%) |
Similarity: | 26/61 - (42%) |
Gaps: | 15/61 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 NDIAILR---LSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
|:::|:: |.|...|....|| |::|.|.| .|..|..:...|.|.|:|
Frog 2 NEVSIVKEGWLHKRGEYIKTWRP---------RYFLLKTD---GTFIGYKERPQDVDQLET 50
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X21 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.