DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18636 and akt1

DIOPT Version :9

Sequence 1:	NP_995714.2	Gene:	CG18636 / 2768923	FlyBaseID:	FBgn0032551	Length:	349	Species:	Drosophila melanogaster
Sequence 2:	XP_004917247.1	Gene:	akt1 / 100490038	XenbaseID:	XB-GENE-484953	Length:	493	Species:	Xenopus tropicalis

Alignment Length:	61	Identity:	17/61 - (27%)
Similarity:	26/61 - (42%)	Gaps:	15/61 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   138 NDIAILR---LSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            |:::|::   |.|...|....||         |::|.|.|   .|..|..:...|.|.|:|
Frog     2 NEVSIVKEGWLHKRGEYIKTWRP---------RYFLLKTD---GTFIGYKERPQDVDQLET 50

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18636	NP_995714.2	Tryp_SPc	44..278	CDD:214473	17/61 (28%)
CG18636	NP_995714.2	Tryp_SPc	45..278	CDD:238113	17/61 (28%)
akt1	XP_004917247.1	PH_PKB	4..111	CDD:269947	16/59 (27%)
akt1	XP_004917247.1	PKc_like	125..491	CDD:419665
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X21
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910