DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:309 Identity:81/309 - (26%)
Similarity:118/309 - (38%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||.|...:...||:.|..|.....||.|.|....:.| ||.::|.||.:::|||||...|.....
 Frog   223 CGTRPAMQKTNRIVGGSDATKGEFPWQVSLRENNEHF-CGATVIGDKWLVSAAHCFNDFQDPAVW 286

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAG----FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            :. |..|.|...|       :...|.|.    .||..|||:|...|:|:|.|...:.:....:|:
 Frog   287 VA-YIATTSLSGT-------DSSTVKATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPV 343

  Fly   159 CVVWDHRWRHYLDKIDLLTATGWGKTQMESDS----DALQTLDIRRQPPDVCAKFIGQTIAGNQF 219
            |:...   .|..........||||  .::.|:    :.||...:......:|.......:.....
 Frog   344 CLPDP---THVFPVGKKCIITGWG--YLKEDNLVKPEVLQKATVAIMDQSLCNSLYSNVVTERML 403

  Fly   220 CAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFT---------- 269
            |||..:..:  |.|||||||   :..:.:.:|...||.|: ...|.:|   .|:.          
 Frog   404 CAGYLEGKIDSCQGDSGGPL---VCEEPSGKFFLAGIVSW-GVGCAEARRPGVYVRVSKIRNWIL 464

  Fly   270 DVLS-------HAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTWWHTTR 311
            |::|       ...|........|..:|   .....||.||.|...|||
 Frog   465 DIISSSVAADPQTSFTTTTTTTTGGRKT---TNAKTTTARPFTKHSTTR 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/263 (25%)
Tryp_SPc 45..278 CDD:238113 66/262 (25%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473 65/246 (26%)
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.