DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:286 Identity:75/286 - (26%)
Similarity:125/286 - (43%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD---MFVCGGSL 75
            :.||..||.||..               |..||.|..::.:|.|:|..|..||:   ...|||.|
  Rat     5 LFLMALLLPSGAG---------------AEEIIGGVESRPHSRPYMAHLEITTERGYKATCGGFL 54

  Fly    76 ITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDI 140
            :|.:.|:|||||  ..:.....||.::.:::|       :.:::..|:....|..|:..::.:||
  Rat    55 VTRQFVMTAAHC--KGRETTVTLGVHDVSKTE-------STQQKIKVEKQIVHPNYNFYSNLHDI 110

  Fly   141 AILRLSK--SVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQM-ESDSDALQTLDIRRQP 202
            .:|:|.|  .|....::.|:....|     :|....:..|.|||:|.: :..|:.|:.:..|...
  Rat   111 MLLKLQKKAKVTPAVDVIPLPQPSD-----FLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMD 170

  Fly   203 PDVCAKFIGQTIAGNQFCAGNWDS--NLCNGDSGGPL-GAVITHKNTQRFVQVGIASYTNRNCQK 264
            .:.|..:..... ..|.|.|:...  :...||||||| .|.:.|         ||.||...:.:.
  Rat   171 KEACKNYFHYNY-NFQVCVGSPRKIRSAYKGDSGGPLVCAGVAH---------GIVSYGRGDAKP 225

  Fly   265 ASVFTDVLSHAEFILRVWRMYGKGQT 290
            .:|||.:..:..:|.:|  :.||..|
  Rat   226 PAVFTRISPYVPWINKV--IKGKDLT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/242 (26%)
Tryp_SPc 45..278 CDD:238113 63/241 (26%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 63/242 (26%)
Tryp_SPc 21..242 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.