DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC100331291

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:272 Identity:76/272 - (27%)
Similarity:111/272 - (40%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||..|:.|...:|:.|..|:..|.||.|.|.......|||.||:..:.:::|||||..:..:   
Zfish   679 CGCGTRPRKRAKIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVASRWLVSAAHCFQDSDAI--- 740

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAG---------FKHKLYDPNTHANDIAILRLSKSVVYRD 153
              :|...||...   |...|..:.|...         ..|..||..|...|||:|.||..|.:.:
Zfish   741 --KYSDARSWRA---YMGMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSAPVFFNE 800

  Fly   154 NIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGN 217
            .::|:||...   .|..........||||....|.: :..||...:.....:.|.|.....:...
Zfish   801 LVQPVCVPAP---SHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMYDDAVTPR 862

  Fly   218 QFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEF 277
            ..||||....:  |.|||||||   :..:..:|:...||.|: ...|   .:..|:|.|:...::
Zfish   863 MLCAGNIQGGVDACQGDSGGPL---VCLERGRRWFLAGIVSW-GEGCARQNRPGVYTRVIKFTDW 923

  Fly   278 ILRVWRMYGKGQ 289
            |    ....|||
Zfish   924 I----HQQTKGQ 931

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/248 (27%)
Tryp_SPc 45..278 CDD:238113 68/247 (28%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060 76/272 (28%)
Tryp_SPc 691..927 CDD:238113 69/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.