DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss15

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:290 Identity:73/290 - (25%)
Similarity:116/290 - (40%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIR-----------TQSRTAYRIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLV 81
            ||:|           |..:...|::.|..|:..:.||||.|     |:      ||.:||..:.:
Zfish   725 CGVRKVPSKSKIIEETDGKKEGRVVGGQDAQRGAWPWMVSLQWLGGHA------CGATLIDREWL 783

  Fly    82 LTAAHCFIANQHLVARLGEYERTRSEECTGYYCNF------REEHMVDAGFKHKLYDPNTHANDI 140
            :|||||.....   .:|..:...     .|.:..|      ::...||....||.|:..|..:|.
Zfish   784 ITAAHCVYGRN---VQLSNWAAV-----LGLHAQFETINPNKQVFSVDQVIMHKHYNKRTKESDF 840

  Fly   141 AILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS----DALQTLDIRRQ 201
            |::.|...|.|.|.::|||:  .....|:.:......| |||   :.|:|    |.||...:...
Zfish   841 ALMHLKTPVSYTDYVQPICL--PDPGAHFEEGRKCFIA-GWG---LLSESGLKADVLQQAVVPLL 899

  Fly   202 PPDVCAKFIGQ-TIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC- 262
            ....|.:::.: .......|||..:..:  |.|||||||..    :....:|.||..|: ...| 
Zfish   900 SNTQCQEWLPEYNFTERMMCAGYAEGGVDTCQGDSGGPLMC----EEEGHWVLVGATSF-GIGCG 959

  Fly   263 --QKASVFTDVLSHAEFILRVWRMYG--KG 288
              |:...:..|....:::....|:|.  ||
Zfish   960 RPQRPGAYARVSQFVDWVAENRRLYSDWKG 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/254 (26%)
Tryp_SPc 45..278 CDD:238113 64/253 (25%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335 2/2 (100%)
Tryp_SPc 747..977 CDD:214473 65/254 (26%)
Tryp_SPc 748..980 CDD:238113 64/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.