DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and proc.2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:249 Identity:70/249 - (28%)
Similarity:111/249 - (44%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            ||:.|...:....||.|.:.:......||||||:.:.||:|||||.:.......:|:|:..|.: 
 Frog   435 RIVGGMRCELGQCPWQVLIRNNRGFGFCGGSLISSRWVLSAAHCFESQIPHHVTIGDYDTYRRD- 498

  Fly   109 CTGYYCNFREEHMVDA--GFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD 171
                    .:|..:..  .|.|..|....:.:|||:|.|....::.:..||||:.     ...|.
 Frog   499 --------MDEQKIAVLQVFSHPNYLAEFYDHDIALLFLRSPAMFGEYSRPICLP-----NPGLG 550

  Fly   172 KIDLLT-------ATGWGKT-QMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD--S 226
            |  :||       .:|||.| |....:..|..:.:.....:.|.......:.||.||||..:  .
 Frog   551 K--MLTQEGQTGQVSGWGATRQFGPYTRFLLKVRLPIVSQETCMASTENILTGNMFCAGYKEGVK 613

  Fly   227 NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA--SVFTDVLSHAEFI 278
            :.|:||||||. ||:.|   ..:..||:.|:.:...:|.  .|:|.|.::..:|
 Frog   614 DACSGDSGGPF-AVLFH---DTWFLVGVVSWGDGCAEKGKYGVYTRVANYMPWI 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/247 (28%)
Tryp_SPc 45..278 CDD:238113 68/246 (28%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 69/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.