DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss12

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:297 Identity:101/297 - (34%)
Similarity:127/297 - (42%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHSGCSQFLD-PACG----IRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM----FVC 71
            |...|...|..|.:| ..||    :.|...   ||:.|..|...:.||.|.|.....:    ..|
 Frog    10 LTLSLCWLGIIQAIDSEVCGEPPLVHTPGS---RIVGGRNALPGAWPWQVSLQYFRTLSGYSHRC 71

  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFK----HKLY 131
            |||||.:..||:|||||.||     |..||.|.    ..|.:..|.| ..:|.|..|    |..|
 Frog    72 GGSLIQNNWVLSAAHCFRAN-----RNPEYWRA----VLGLHNIFMEGSPVVKAKIKQIIIHASY 127

  Fly   132 DPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI---DLLTA---TGWGKTQME-SD 189
            |.....||||:|.|...|.|.|.|.|:|          |..:   |.|||   ||||.|:.: |.
 Frog   128 DHIAITNDIALLLLHDFVTYSDYIHPVC----------LGSVTVPDSLTACFITGWGVTKEKGSI 182

  Fly   190 SDALQTLDIRRQPPDVCAK------FIGQTIAGNQFCAGN----WDSNLCNGDSGGPLGAVITHK 244
            |..||...::..|...|..      ||.|::    .|||:    .||  |.||||||.  |..:.
 Frog   183 SVILQEALVQTIPYSECNSSSSYNGFITQSM----ICAGDNSGAVDS--CQGDSGGPF--VCYNT 239

  Fly   245 NTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFI 278
            ...||.|:||.|: ...|.|.:   |:|.|.|:..:|
 Frog   240 ERMRFYQMGITSF-GYGCGKPNFPGVYTKVESYVSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 92/262 (35%)
Tryp_SPc 45..278 CDD:238113 91/261 (35%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 92/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.