DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:165423

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:319 Identity:94/319 - (29%)
Similarity:143/319 - (44%) Gaps:52/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCS---QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73
            :.::.:..||.:||.   ....||||   ::....:|:.|..|...|.||...||.:...| |||
Zfish     5 LSLLCVVTLLSTGCDCQPTQSPPACG---KAPLNTKIVGGTNASAGSWPWQASLHESGSHF-CGG 65

  Fly    74 SLITDKLVLTAAHCFIANQH---LVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFKHKLYDPN 134
            |||:|:.:|:|||||.:|.:   ....||.    :|::..    |..| ...|.....|.||..:
Zfish    66 SLISDQWILSAAHCFPSNPNPSDYTVYLGR----QSQDLP----NPNEVSKSVSQVIVHPLYQGS 122

  Fly   135 THANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES-----DSDALQ 194
            ||.||:|:|.||..|.:.:.|:|:|:..|....:.    |.:..||||  .:||     ....||
Zfish   123 THDNDMALLHLSSPVTFSNYIQPVCLAADGSTFYN----DTMWITGWG--TIESGVSLPSPQILQ 181

  Fly   195 TLDIRRQPPDVCAKFI--GQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIA 255
            .:::.....::|....  |.:|..|..|||  ....:.|.||||||:  ||...||  :||.|:.
Zfish   182 EVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPM--VIKSFNT--WVQAGVV 242

  Fly   256 SYTNRNCQKAS---VFTDVLSHAEFILRVWRMYGKGQTLPIPKKPP------TTTRPPT 305
            |: .:.|...:   |:..|..:..:|    ..|.:...:|:....|      |....||
Zfish   243 SF-GKGCADPNYPGVYARVSQYQNWI----SQYVRASFIPVDVNAPIQDDSETCPTKPT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 79/249 (32%)
Tryp_SPc 45..278 CDD:238113 79/248 (32%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 79/249 (32%)
Tryp_SPc 38..269 CDD:238113 80/254 (31%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.