DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gm2663

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:272 Identity:73/272 - (26%)
Similarity:106/272 - (38%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ 92
            ||..|..:...|..  :|:.|:|...:|.|:.|.|:.... ..||||||.|:.||:||||:  .:
Mouse     9 FLGAAVALPANSDD--KIVGGYTCPKHSVPYQVSLNDGIS-HQCGGSLINDQWVLSAAHCY--KR 68

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNI 155
            .|..||||:.....|         ..|..:||.  .:|..|:.:|..|||.:::|....:....:
Mouse    69 RLQVRLGEHNIDVLE---------GGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQV 124

  Fly   156 RPI------------CVVWDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQTLDIRRQPPDVC 206
            ..:            |:|                 :|||.|......  ..||.|:........|
Mouse   125 STVSLPRSCASTNAQCLV-----------------SGWGNTVSIGGKYPALLQCLEAPVLSASSC 172

  Fly   207 AKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ---KAS 266
            .|.....|..|.||.|  ....:.|:||||||   |:.:...|..|..|..      |.   |..
Mouse   173 KKSYPGQITSNMFCLGFLEGGKDSCDGDSGGP---VVCNGEIQGIVSWGSV------CAMRGKPG 228

  Fly   267 VFTDVLSHAEFI 278
            |:|.|.::..:|
Mouse   229 VYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/254 (27%)
Tryp_SPc 45..278 CDD:238113 68/253 (27%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 68/254 (27%)
Tryp_SPc 24..243 CDD:238113 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.