DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and f7l

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:270 Identity:79/270 - (29%)
Similarity:120/270 - (44%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAH 86
            :|.|....|.:||.........||:.|........||...| .....:.|||.::..:.::||||
Zfish   172 NSSCVPTADFSCGRPVAKGVGPRIVKGDVCPKGQCPWQALL-EYDGQYKCGGVILNSQWIITAAH 235

  Fly    87 CFIANQHLVAR--LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSV 149
            |.......:.:  :||:.|.|.|       ...:...|...|.|..|:.::..:|:|:|||.:.|
Zfish   236 CIWRKDPALLQVIVGEHIRDRDE-------GTEQMRKVSEVFLHPQYNHSSTDSDVALLRLHRPV 293

  Fly   150 VYRDNIRPICVVWDH-RWRHYLDKIDLLTATGWGK-TQMESDSDALQTLDIRRQPPDVCAKFIGQ 212
            .......|:|:...: .:...|..|.:.|.:|||: .|....|..||.|.:.|...:.|....|.
Zfish   294 TLGPYALPVCLPPPNGTFSRTLASIRMSTVSGWGRLAQSGPPSTVLQRLQVPRVSSEDCRARSGL 358

  Fly   213 TIAGNQFCA----GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASV---FTD 270
            |::.|..||    |..||  |.|||||||  |..::||  :...||.|: .:.|.:|.|   :|.
Zfish   359 TVSRNMLCAGFAEGGRDS--CQGDSGGPL--VTRYRNT--WFLTGIVSW-GKGCARADVYGIYTR 416

  Fly   271 VLSHAEFILR 280
            |....|:||:
Zfish   417 VSVFVEWILK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/244 (30%)
Tryp_SPc 45..278 CDD:238113 71/243 (29%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.