DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:dkey-78l4.6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003201079.2 Gene:si:dkey-78l4.6 / 100034588 ZFINID:ZDB-GENE-060503-83 Length:251 Species:Danio rerio


Alignment Length:257 Identity:68/257 - (26%)
Similarity:109/257 - (42%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDMF---VCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            |::|..||.:|.|:||    :..:|   :|||.||:|:.|||||.|:..||.|...:|.::..:.
Zfish    26 IVDGQEAKPHSRPYMV----SVQLFGQNICGGFLISDQFVLTAAQCWHQNQDLTVVVGAHDLRKR 86

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD 171
            :....:        :|.:...|..::..|..|||.:|:|...|...:.||||.:..:..    ..
Zfish    87 QNSKNF--------IVKSHITHPNFNSKTFENDIMLLKLKGKVPLNNKIRPISLPKNGE----SF 139

  Fly   172 KIDL-LTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNL------ 228
            |.|. .:..|||:...:.. ||.|  |:.:            ..|..:..|...|.|:.      
Zfish   140 KADTPCSVAGWGRLWTKGPVSDLL--LEAK------------TAIVNDAECKLRWGSHYVPSMMI 190

  Fly   229 --------CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN-CQK---ASVFTDVLSHAEFI 278
                    ||||.||||    ...||    .||:..:.:|. |..   .:|:|.:.::..:|
Zfish   191 CAFGHGGSCNGDGGGPL----VCNNT----AVGVTIFRDRYLCNSRLLPNVYTKISAYLPWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/255 (26%)
Tryp_SPc 45..278 CDD:238113 67/255 (26%)
si:dkey-78l4.6XP_003201079.2 Tryp_SPc 26..247 CDD:238113 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.