DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and plaua

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:270 Identity:72/270 - (26%)
Similarity:119/270 - (44%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIA------N 91
            ||.|...|.. :||.|..:...|.|||..:.. .|.|:|||:|||...||||||||..      |
Zfish   153 CGERRLDRQT-KIIGGLRSTVESQPWMAAIFK-GDGFICGGTLITPCWVLTAAHCFPTGKRTQIN 215

  Fly    92 QHLVA----RLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNT--HANDIAILRL----S 146
            ::.|.    .:.|.:..:.::.|           |.....|:.:|.:|  :.:|||:|::    .
Zfish   216 RYSVVLGKNAINETDPVKEQKFT-----------VSRLVIHEDFDYSTENYTHDIALLKIEDCNG 269

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES--DSDALQTLDIRRQPPDVCAK- 208
            :..|....:|..|:   ..::..|.........|:|:.|..:  .|..|:..:::.....||.: 
Zfish   270 QCAVKTKTVRTACL---PPFQQMLPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQRT 331

  Fly   209 -FIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK--ASVF 268
             :....:..|..||.  :|.::.|.|||||||   :...|...|: .||.|:.....:|  ..|:
Zfish   332 YYNKDEVNENMLCANGRDWKTDACQGDSGGPL---VCEVNNIMFL-FGIISWGKECAEKNQPGVY 392

  Fly   269 TDVLSHAEFI 278
            |.|.::.::|
Zfish   393 TQVSNYNQWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/257 (26%)
Tryp_SPc 45..278 CDD:238113 67/256 (26%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.