DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:163079

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:303 Identity:79/303 - (26%)
Similarity:113/303 - (37%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH-STTDMFVCGGSLITDKLVLTAAH 86
            :||....| .|| |....|  :||.|..|...|.||...:: ..|:.|.||||||....|||.|.
Zfish    18 AGCLGQSD-VCG-RAPLNT--KIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAK 78

  Fly    87 CF--IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSV 149
            .|  :....:|..||...:..|..       :.....|....||..|  |:..:::|:|:||..|
Zfish    79 VFALMPASDIVVYLGRQTQNGSNP-------YEISRTVTKIIKHPNY--NSLDSNLALLKLSSPV 134

  Fly   150 VYRDNIRPICVV------------WDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR-- 200
            .:.|.|:|:|:.            |               .||||.....:..:.:...|:.:  
Zfish   135 TFSDYIKPVCLAAAGSVFVDGTASW---------------VTGWGYLNRPATVEEIMLPDVLQEV 184

  Fly   201 QPPDV----CAKFIGQTIAGNQFCAG--NWDSNL-CNGDSGGPL----GAVITHKNTQRFVQVGI 254
            :.|.|    |....|..|.....|||  |.|... |.||.||||    ||:        ::|.|:
Zfish   185 EAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAI--------WIQSGV 241

  Fly   255 ASYTNRNCQKASVFTDVLSHAEFILRV-----WRMYGKGQTLP 292
            .         .|.:..:..:....:||     |..|....:||
Zfish   242 V---------VSGYCGLPGYPTIYVRVSEYEDWISYYTNSSLP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/261 (25%)
Tryp_SPc 45..278 CDD:238113 66/260 (25%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 68/271 (25%)
Tryp_SPc 36..267 CDD:238113 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.