DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and gzm3.3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:250 Identity:68/250 - (27%)
Similarity:101/250 - (40%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFL----HSTTDMFVCGGSLITDKLVLTAAHC-----FIANQHLVARLGE 100
            ||.|..||.:|.|:|..:    |.|     |||.||.|..|||||||     :....||...||.
Zfish    22 IIGGKVAKAHSRPYMASIQINKHHT-----CGGMLIRDDYVLTAAHCLNRGVYSGRGHLEVVLGA 81

  Fly   101 YERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN---THANDIAILRLSKSVVYRDNIRPICVVW 162
            :..::.|:       .::...|....:|.::..|   .::.||.:|:|.........::.|.:..
Zfish    82 HNISKHEQ-------NQQRIQVKKYIRHPMFQRNKEKDYSYDIMLLKLKNKAKISKFVKVISLPK 139

  Fly   163 DHRWRHYLDKIDL---LTATGWGKTQMESD--SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG 222
            .:      .||..   .:..|||.|:.:::  ||.|:.:.::.|....|.....|.....:....
Zfish   140 KN------GKIPANVKCSVAGWGLTKPKAELASDVLEEVTLKLQFDFECKTMWQQHFNTERMICS 198

  Fly   223 NWDSN--LCNGDSGGPLGAVITHKNTQRFVQVGIASYT-NRNC---QKASVFTDV 271
            ..|..  .|.|||||||   |.:...|     .|.||| ..||   |...||..:
Zfish   199 VSDGKHAFCQGDSGGPL---ICNTKPQ-----AIVSYTFEGNCINKQYPQVFLKI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/249 (27%)
Tryp_SPc 45..278 CDD:238113 68/249 (27%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 68/249 (27%)
Tryp_SPc 22..252 CDD:214473 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.