DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss3a

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:299 Identity:77/299 - (25%)
Similarity:115/299 - (38%) Gaps:82/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQH--- 93
            |||.|  .:.:.||:.|:.:.....||.|.||...: .:||||:||.:.:||||||.....:   
Zfish   287 ACGSR--PKFSARIVGGNLSAEGQFPWQVSLHFQNE-HLCGGSIITSRWILTAAHCVYGIAYPMY 348

  Fly    94 --LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
              :.|.|.|..           .|..:...|:....|..|.|....:|||:::|::.:.:...:.
Zfish   349 WMVYAGLTELP-----------LNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVE 402

  Fly   157 PICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQP---------PDVCAKFIGQ 212
            |||:   ..:....:...:...:|||.|  |...||..:......|         |:|   :.|.
Zfish   403 PICL---PNFGEQFEDGKMCWISGWGAT--EDGGDASVSQHCASVPLISNKACSQPEV---YQGY 459

  Fly   213 TIAGNQFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHA 275
            ..|| ..|||..|  ::.|.|||||||.                       |:.:|         
Zfish   460 LTAG-MICAGYLDGGTDSCQGDSGGPLA-----------------------CEDSS--------- 491

  Fly   276 EFILRVWRMYGK---GQTLPIPKKPPTTTR---PPTWWH 308
                 :|::.|.   ||......||...||   ..||.|
Zfish   492 -----IWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIH 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/249 (25%)
Tryp_SPc 45..278 CDD:238113 61/248 (25%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 4/6 (67%)
Tryp_SPc 298..525 CDD:238113 71/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.