DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment squ and CG15484

DIOPT Version :9

Sequence 1:NP_001246044.1 Gene:squ / 2768920 FlyBaseID:FBgn0267347 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609587.1 Gene:CG15484 / 34682 FlyBaseID:FBgn0032452 Length:206 Species:Drosophila melanogaster


Alignment Length:216 Identity:101/216 - (46%)
Similarity:142/216 - (65%) Gaps:22/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAWVPNSQFEDDLVDMEPDFNFVHGQLAYDMKKQGEFWPR-PKCTYEYLKSREKRNSELENIHGS 64
            |||||.|:||.|||.:||.||.||||:||:::|:.||... |..|||.|.:||....     :|:
  Fly     1 MAWVPTSRFEHDLVQLEPHFNLVHGQIAYELRKKEEFSESVPIHTYELLTAREDLLG-----YGT 60

  Fly    65 RGGTGRDIRQSLQLMENIQKIAGTRPLGEHATMKDWEDESTNELEALAMMRHFGMMSMATDSLPV 129
            |||.||:||||||:||.||::|||:||||||||:||||.:..::||:|::|:||.|::..|||.:
  Fly    61 RGGKGREIRQSLQMMETIQRVAGTKPLGEHATMEDWEDTTMVDVEAIAIIRNFGRMTLKQDSLTL 125

  Fly   130 LPEVKPPEGPIKIIRNGRKQFPLITDPEFFKPRKIPRTK---------NSSSSSSYHTANSSISS 185
            .|::..|    .:..|..::||||||.:||.||||.|.|         ::|:..|:|||.|  .|
  Fly   126 QPQISLP----AVAPNESQRFPLITDRDFFTPRKIRRPKDLPPVENSPDNSADDSFHTAKS--LS 184

  Fly   186 FSLYESAASDLDSSKKQGEIK 206
            ..::.:.....|.:.| |||:
  Fly   185 NCIWLNGLKYPDKTSK-GEIQ 204



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452922
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BXVF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019400
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.