DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and CG34462

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:210 Identity:48/210 - (22%)
Similarity:84/210 - (40%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YDFSYGVHDSITGDIKSQVETR-DGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQ-----R 193
            |.|.|.::|..|.:.:.:.|.| ..|::.|||.....||......|.|.:..|::|.:|     .
  Fly    62 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGD 126

  Fly   194 EPVVAARAVAAPVVSVS-APAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQQGEVVES 257
            |.|.:......|.:.|. :.:..|.:|:..|.:.|...:.:     .|....||:.:|.|..:..
  Fly   127 EKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSH-----VADHVAQQLKQQHGLDLNH 186

  Fly   258 PVAQQPELEPTPIDYNEGQQQQQEQQ-QQTYPQDQQFPPYS-PAGQSSPAPDSDDSDVVEARSAP 320
            ....:..|:|..:|..:|::..:.:. |...||.....|:. ||.|.:....:.:....|:....
  Fly   187 IDVTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKYH 251

  Fly   321 EASSTTTTAAPVTEE 335
            .|.|.....|...||
  Fly   252 RAQSNNAEKAQQVEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 15/52 (29%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.