DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr92A

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:320 Identity:105/320 - (32%)
Similarity:126/320 - (39%) Gaps:103/320 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLLTVFSLLAIAASCRAGFAATYAGY---HPAYATYQAPAAVYHAAPVAQAAVYQQAAPVYAKTF 65
            |:..:.::|.||          |||.   .|.|.....|..::|         |...||.:.   
  Fly     3 KISLLSAMLGIA----------YAGVIGPGPYYGGPAGPGPLHH---------YGGYAPQHG--- 45

  Fly    66 VPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELE 130
                       .||.|.   |||.|              |||....|                  
  Fly    46 -----------PLPGPY---VAPKP--------------AAPEPYDP------------------ 64

  Fly   131 SSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREP 195
             .|:|.|.|.:.|..|||:|||.|||.|..|.|||||:|.||.||||.||||..:||||||::||
  Fly    65 -DPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEP 128

  Fly   196 VV-AARAVAAPVVSVSAPAPVPVHISSAPVASLP----APIY-YP------HQQVFAPQQIQQVA 248
            :. .|.|..||||: .||||||.|...||...||    ||:. ||      |:...||......|
  Fly   129 LAYKAPAHLAPVVA-PAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPA 192

  Fly   249 EQQGEVVESPVAQQPELEPTPIDYNEGQQQQQEQQQQTYPQDQQFPPYS--PAGQSSPAP 306
            ..... |..|||       ||:       .........||. ....||:  ||...:|||
  Fly   193 PAPAP-VSVPVA-------TPV-------LPSAHFHAAYPA-LAHSPYAHYPAPGPAPAP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 31/51 (61%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 22/114 (19%)
Chitin_bind_4 68..120 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.