DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:194 Identity:88/194 - (45%)
Similarity:106/194 - (54%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YALPTPVVKAVAPAPLALPV---AAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDF 137
            :||....|.:...||:|.|.   |||.|.|.|.|||..|..|...||.       |.:..|:|.|
  Fly     7 FALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAE-------EYDPHPQYRF 64

  Fly   138 SYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAV 202
            ||||.|.:|||.|.|||.|||..|.|.||::||||:||.|.||||.||||||||.|||:|.|.||
  Fly    65 SYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAV 129

  Fly   203 AAPVVSVSAP-----APVPVHISSAPVASLPAPI-YYPHQQVFAPQQIQQVAEQQGEVVESPVA 260
            |..|.:|:||     ||...|.::..|....||: :|.     ||..::.||         |||
  Fly   130 APVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA-----APAVVKTVA---------PVA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 34/51 (67%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.