DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:266 Identity:102/266 - (38%)
Similarity:127/266 - (47%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YALPTPVVKAVAPAPLALPV---AAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDF 137
            :||....|.:...||:|.|.   |||.|.|.|.|||..|..|...||.       |.:..|:|.|
  Fly     7 FALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAE-------EYDPHPQYRF 64

  Fly   138 SYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAV 202
            ||||.|.:|||.|.|||.|||..|.|.||::||||:||||.||||.||||||||.|||:|.|.||
  Fly    65 SYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAV 129

  Fly   203 AAPVVSVSAP-----APVPVHISSAPVASLPAPI-YYPHQQVFAPQQIQQVAEQQGEVVESPVAQ 261
            |..|.:|:||     ||...|.::..|....||: :|.     ||..::.||         |||.
  Fly   130 APVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA-----APAVVKTVA---------PVAH 180

  Fly   262 QPELEPTPIDYNEGQQQQQEQQQQTYPQDQQFPPYSPAGQSSPAPDSDDSDVVEARSAPEASSTT 326
            .    ..|..|            .||.        :|...::||          ..:||.|:.|:
  Fly   181 Y----AAPAAY------------ATYA--------APTHYAAPA----------HYAAPAATYTS 211

  Fly   327 TTAAPV 332
            .:|..|
  Fly   212 YSAPAV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 35/51 (69%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.