DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:312 Identity:89/312 - (28%)
Similarity:113/312 - (36%) Gaps:127/312 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSLLAIAASCRAGFAATYAGYHPAYATYQAPAAVYHAAPVAQAAVYQQAAPVYAKTFVPAAPVYT 73
            |.|:|:.:.|   .||..||..|.....|.|.  .:.|...|..:||:...::            
  Fly     3 FKLVALVSCC---LAAVSAGLIPVEQHDQHPQ--LYQAHQPQHVIYQKQHEIH------------ 50

  Fly    74 RSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFS 138
                   |....|.|.                                        :..|:|:|:
  Fly    51 -------PHGHEVYPD----------------------------------------DPHPKYNFA 68

  Fly   139 YGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAAR--- 200
            |.|.|:::||.|||||:|||..|.|.||:.|||||:|||.||||.:|||||||.|||:....   
  Fly    69 YDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKV 133

  Fly   201 AVAAPVVSVSAPAPVPVHISS---------APVASLP---APIYYPHQQVFAPQQIQQVAEQQGE 253
            ..||||....|||.....|.|         ||..:.|   ||.|..||                 
  Fly   134 VAAAPVQYHHAPAAAAAVIKSYASPSQAYVAPTYAAPAYTAPAYATHQ----------------- 181

  Fly   254 VVESPVAQQPELEPTPIDYNEGQQQQQEQQQQTYPQDQQFPPYSPAGQSSPA 305
                  |:||              |::|.||..|           |...|||
  Fly   182 ------AEQP--------------QEREHQQHHY-----------ASYESPA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 32/51 (63%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.